PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131124001
Common NameGSBRNA2T00131124001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 280aa    MW: 31376.1 Da    PI: 7.6744
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131124001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57345.81.7e-1484123948
               DUF573   9 eeDeivlLqGlidfkaktgkspsddidafyefvkksisfk 48 
                          ++Dei++LqG+idfk++tg sp+dd++a y+f+kksis++
  GSBRNA2T00131124001  84 DNDEIAVLQGMIDFKKDTGNSPYDDTNAYYDFIKKSISIE 123
                          79***********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.9E-984122IPR007592Protein of unknown function DUF573
Gene3DG3DSA:1.25.10.105.4E-8146241IPR011989Armadillo-like helical
SuperFamilySSF483711.32E-8147240IPR016024Armadillo-type fold
CDDcd000208.62E-5148237No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005488Molecular Functionbinding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MCATLKTIVL VFLLCFVALP LEKKLIIFHQ RKKKTTSPTL LPPPSLQSPG EVSAAPSEGT  60
SKETNSKQAK KDDEKRDTWN SPYDNDEIAV LQGMIDFKKD TGNSPYDDTN AYYDFIKKSI  120
SIEDLMGWLL SPTACRKRES RREEEKRACH AIGLIGVTRR CRGLLVEARV VPALVDLFRD  180
GDEKGKILAG NALEIIAAQT EYIRLVTEAG SIPLYVELLS GGDSMGKDIV EDVFSILECL  240
FVTFVSCRCL YIHTCTKRVS NQWRWSNHLT NRAPYHEIS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.130569e-44microspore| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131124001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A078BY920.0A0A078BY92_BRANA; BnaC01g01560D protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.13e-15DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]